master jaguar catalog fifteenthedition · table of contents · performance ... xks unltd performance parts 76-88 engineperformance and vintagerace ... conversions car accessories 24-27 exteriorbadgeslicenseframesleapers and ... fender trim exhaust/mufflers 90-91 headersstainless ... steelmufflers mirrors 28-30 exterior options and interior dash mounts ... windscreens and hood hold-downs engine cooling 94-95 flex-fanselectric fans ... tanks and alloy radiators lighting-electrical 33-35 auxiliary lights replacement ... upgrades 42 air conditioning kits for e-type and earlysedanswheels knock-offs ...
73
manuals areapproximately 30 pageseach and include primary chassis and ... gauges starting ignition switchesfuel and lighting systemsarecovered xk-120 ... booklet xk-140 wiring booklet xk-1 early wiring booklet 50 xk-1 late wiring ... booklet 50 e-type 3.8 wiring booklete-type 4.2 ser i wiring booklete-type 4.2 ser ... ii wiring booklete-typeser iii v-12 wiring booklet mk ii ...
28 29 20 21 18 17 18 16 19 carburetors/fuelsystem starting carburetor 16 banjo ... starting pipeflange on manifold xk-120 early mk vii c2381 27 spring anti-blow-back ... in starting pipe banjo bolt xk-120 from engine w.2449-on all xk-140 mk vii up to ... engine n.4698 c4204 29 gasket xk-140 later mk ... only to xk-120 xk-140 mk vii grose-typecarburetorjets 2 balls oneweak point ... and ultimately a fire hazard grose-typejets withstand high seatpressures and ... we highly recommend upgrading to grose-typejets for standard s.u carburetors 03- ... back in production by s.u in englandthe original manufacturerthereal ... thing for series i e-type front carburetor 03-aud112f center ...
our suppliers mann mahleare original equipmentmanufacturersthese brands are first- ... theyforgetsomethingchangethe oil every 3,000 miles using brand-name oil all ... filterstakethe dirt out of the air elementary if you re only going to keep your car ... until it reaches 50,000 miles don t evenbother changing it but if you want to ... filterthe air the dirt gets into your engine your vw® drinks about a quart of air/ ... a cup of dirt peryear going into your engine would you throw a cup of dirt into the ... engine of your car the dirt getsbetween your ... that some dirt gets by the rings and ends up in the oil and then in thebearings ...
46
fuelinjection daily driversection [1 fuel tanks wesell a variety of excellent ... seecoversectionpre-pump two pump systems in 1985 vw® changed to a two pump ... systemthere is an in-tank pre-pumptransfer ... pump on many models it is part of thefuelsender and accessed from underthe ... plateunderthe back seatfuelpre-pumpcabriolet `85-93 golf `85-92 ... ® ® is simple trust meremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ... your vehicletheseitemsare sold on an exchange basis corecharges apply [5 pressure ...
95 cam 570g 585g 570g 585g 570g 585g fuelsystemsupere carb supere carb super ... e carb supere carb supere carb supere carb piston type 92-1200 series 92-1200 ... s&s® 95 hot set up kits® for 2001 06 fuelinjected big twins with stock cylinder ... cleaner s&s teardrop air cleaner piston type 92-1200 series 92-1200 series 92-1200 ... 1,444.95 92-1200 series piston all 2006 fuelinjectedharley-davidson® big twin ... modelsexcept dynatm porting of stock cylinderheads ... to takeadvantage of cam lift kits fit engines with delphi® fuelinjectionsystem only ... s&s® 103 hot set up kits® for 2007-up fuelinjected big twins with stock cylinder ...
65
® hot set up kits® for 1999-up big twin engines 100 horsepower without breakingthe ... from your motorcycle without major engine work installing one of these hot set up ... kits can beeasier than a routine top end job replacethe stock cylinders pistons ... stock flywheelsthen install the s&s fuelsystem of your choice to makesurethe ... engine can breathe and getthefuel it needs to achieve that magic 100 ... horsepower that s it s hig h l ude s s etsnowincce tapp an pe r fo r m kits ... gaskets kits are sold without a fuelsystem so you can purchaseeitherthesupere ...
5.4l crateenginessupercharged 5.4l 2009 svt mustang ... engine m-6007-c54 supercharged 5.4l dohc ... engine original equipment in the 2009 svt mustang 500 hp 6000 ... sold separately · perfect for your high-endproject · shipping weightapproximately ... 837 lbs see also · crateengine warranty · engine tips specs ... a latemodel 5.4l 4v superchargedengine · designed to run m-6007-c54 and m-6007 ... -tvs 5.4l superchargedcrateengines · includes pcm with ford racing ... cold air kit m-9603-svt07 · includeselectronicthrottle control acceleratorpedal ... eliminatesthrottlecable routing problems · ... ford racing calibration requiresreturntypefuelsystem will not work with ...
84
5.4l crateenginesromeo 605 engine 5.4l 4v w/tvs supercharger m-6007-tvs ... assembled at ford motor company s romeoengine plant nicheassemblyline with ford ... tvs supercharger · theromeo 605 enginecapturestheessence of svt by offering ... a production-basedperformanceengineenhanced with ford racing parts for increased ... upscaleappearance · the most powerfulengineever from a ford production line · a ... combination of raceengine shop performance and customization at ... and 2.3l twin vorticesseries tvs eaton4-lobe 160 degree twist rotors ... sold separately · perfect for your high-endprojectsee also · crateengine ...
fuelinjection daily driversection [1 fuel tanks wesell a variety of excellent ... seecoversectionpre-pump two pump systems in 1985 vw® changed to a two pump ... systemthere is an in-tank pre-pumptransfer ... pump on many models it is part of thefuelsender and accessed from underthe ... plateunderthe back seatfuelpre-pumpcabriolet `85-93 golf `85-92 ... ® ® is simple trust meremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ... your vehicletheseitemsare sold on an exchange basis corecharges apply [5 pressure ...
8
e t ch t ip daily driversection hot ... start problemnewfuelpressure accumulator all rabbit® ... jettas® dashers® golfs® quantum® audis® etc from `77 through approximately `88 have ... cis fuelinjection continuous injectionone of ... you turn off the car theheat from theengine and exhaustpipe soaks into the ... an air space in thelinebetweenthefuel tank and the pump and the pump can t ... to this problemone of which was thefuelpressure accumulator thefuelpressure ... whenthe pump is turned on thefuel pump pressurecompressesthe spring ...
LEATHER BLACK LEATHER GRAY LEATHEREXTERIOR COLORS ONYX BLACK (Sports Sedan, 5-Door ... MAZDA6 i)* O S S 200-watt Bosespeakersystem with 4 full-rangespeakers, 2 tweeters ... and rearcoverageDVD-based navigation system with retractablescreen - - O O Sport ... O/A S O/A S Fog lights - S S S Aluminum fuel-filler door (chrome or satin finish) O/A O/A O ... /A O/A Door-edge guards, color-keyed O/A O/A O/A O/A All ... moonroof) O/A O/A O/A O/A Remoteengine start (A/T only) O/A O/A O/A O/A SIRIUS ... kit. Available only in the U.S., except Alaska and Hawaii. PECIFICATIONS MAZDA6 ... 2.3L DOHC MZR 16-valve4-cylinderengine MAZDA6i MAZDA6i MAZDA6i MAZDA6i 3.0L ... DOHC MZI 24-valve V6 engine MAZDA6s MAZDA6s MAZDA6s MAZDA6s 5- ...
15
2.3L DOHC MZR 16-valve4-cylinderengine S - - 3.0L DOHC MZI 24-valve V6 ... engine - S S 5-speed manual overdrive ... rack-and-pinion steering with S S S engine-speed-sensingvariablepower assist Power-assisted ... disc brakes S S S Anti-lock BrakeSystem (ABS) with S S S ElectronicBrakeforce ... Distribution (EBD) Traction Control System (TCS) S S S Double-wishbone front ... suspension with stabilizer bar S S S E-type multilink rearsuspension with ... -installedaccessory -: Not availableEnginesize and type 2.3L DOHC 16-valve 4- ... Compression ratio 9.7:1 10.0:1 Ignition system Fully transistorized Fully ... transistorizedbreakerlesselectronicbreakerlesselectronicFuelsystem ...
and Aviation Technologyreciprocatingengines, turbines, lubrication systems, engine ... fuelsystems, fuelmeteringsystems, induction systems, ignition systems, ... engineelectricalsystems, engine cooling systems, engineexhaustsystem ... , engineinstrumentsystems, enginefireprotectionsystems and propellers ... . Depending on the individuals aircraft experience and previouslicenses, some individuals ... c t i n s t r u c t o r f o r f u r t h e r information. The following courses ( ... certificate: AERO 80F, ReciprocatingEngineTheory (10) AERO 80G, TurbineEngine ...
86
84 AutomotiveTechnology AUTO 71B *ELECTRONICFUELINJECTION 4 units 72 hours total ... Completion of AUTO 50A and AUTO 68. and Eligibility for ENGL 50BR4, ENGL 51BR2 and MATH A. ... in understanding, diagnosis and testingelectronicfuelinjectionsystems. This course ... will coversystemsused on American Motors, Chrysler, Ford ... Advisory: Completion of AUTO 50A, and Eligibility for ENGL 51BR2 and MATH 50. A course in ... repair of automotivebrakes and braking systems. (AVC) AUTO 72B *AUTOMOTIVESUSPENSION, ... Advisory: Completion of AUTO 50A, and Eligibility for ENGL 51BR2 and MATH 50. A course in ... Advisory: Completion of AUTO 50A, and Eligibility for ENGL 51BR2 and MATH 50. A course in ...
questionanswertechnical information efiwet dry systemshereareanswers to ... askedquestions about nos nitrous oxidesystems along with tech information compiled by ... research and developmentteamhiddensystems q a will nitrous affectengine ... not usually causeincreasedwear as theenergyreleased in thecylinderincreases so ... must handlethem if the load increasesexceedthe ability of thecomponents to handle ... at wideopenthrottle nitrous can beextremelyadvantageous in that it is only used ... the most powerful and reliable nitrous systems in the world q a q a where can i get my ...
8
questionanswertechnical information efiwet dry systems q a aretherebenefits ... applications turbo lag is completelyeliminated with the addition of a nitrous system ... of nitrous a tremendousintercoolingeffectreducesintakechargetemperatures by ... is usually increased as well adding to evenmorepowerexceed 15 to 1 generallythe ... retard as well as higheroctanefuel is required for morespecific ... how important is it to use nitrous and fuelfilters in a kit some of the most ... important components of any nitrous systemare nitrous and fuelfilters to keep ...
Air Valve C. Thermo-Time Switch E. Combi Relay F. Vacuum Limiter G. Cold ... Start Valve H. FuelInjectionValve I. InjectorSeals J. ... EngineTemperatureSensor K. Resistor Unit L ... . OxygenSensor B Electronic Control Units Note: Thecorecharge is ... you afterwereceive your rebuildableexchange. Core must bereturned in original box ... . C F E G I J L K H D I L N O P Q M Keep Your ... FuelInjectorsCleanFuelSystemCleaner controls carbon build-up on ... valves and cleans your entireenginefuelsystem. Regularuseimproves ... A 127 Underhood 7 www.mamotorworks.com FuelInjectionComponents A Bus 74-75 ...
139
FuelPressureRegulator A very important ... part of thefuelsystemwhen running an electric pump or Weber ... carbs, as theyaresensitive to fuelpressure. Quickly easilyadjustable ... and gas mileage. Single IDF kits areexcellent for mid-performance and off-road ... make both carbs work together as one. Easy to install. Made from stainlesssteel, ... , for two carburetors 108-008 $79.99 FuelPressureRegulator, adj., fits ... carbureted 375-245 $26.99 FuelPressureRegulatorBracket, fits ... carbureted 375-246 $6.99 FuelHose Fittings 1/4 , fits above 375-245 ... (2pc) 313-280 $3.99 131 Pu rs u e y o u r pas s i o n fo r A i r- Co o l ...
95 cam 570g 585g 570g 585g 570g 585g fuelsystemsupere carb supere carb super ... e carb supere carb supere carb supere carb piston type 92-1200 series 92-1200 ... s&s® 95 hot set up kits® for 2001 06 fuelinjected big twins with stock cylinder ... cleaner s&s teardrop air cleaner piston type 92-1200 series 92-1200 series 92-1200 ... $1,354.95 $1,444.95 $1,444.95 all 2006 fuelinjectedharley-davidson® big twin ... modelsexcept dynatm porting of stock cylinderheads ... to takeadvantage of cam lift kits fit engines with delphi® fuelinjectionsystem only ... s&s® 103 hot set up kits® for 2007-up fuelinjected big twins with stock cylinder ...
79
® hot set up kits® for 1999-up big twin engines kits include s&s super stock cylinder ... gaskets kits are sold without a fuelsystem so you can purchaseeitherthesupere ... carb kit an s&s singleboreefi kit or a complete s&s variablefuel ... injection vfi kit to finish theengine two types of kits onetype of kit ... are mainly intended for converting 88 engines to 95 or converting 96 engines to 103 ... by replacingthecylinderstheease and speed of this conversion is a ... definiteadvantage and may make it cost effective to use for existing 95 or 103 engines ...
36 Pu rs u e y o u r pa s s i o n fo r Co r vette h ... ere Toll Free: 800.500.1500 Idle Air ... Test Tool. Allows you to measuretheECMcurrent signal with your digital ... PressureSensorTestHarnessCorvetteengineperformancedependsheavily upon the ... . This information is fed to theECM, which uses it to adapt fuelmixture to ... different driving conditions. It even adapts to differentaltitudes. This ... to measuretheintake air demand of theengine. If this sensor is not functioning ... properly, your engine will not receivetheproperair/fuel ... SensorTestHarness A knock sensor is essential for maximum performance. It listens for ...
40
37 Pu rs u e y o u r pa s s i o n fo r Co r vette h ... ereEngine/Performance www.mamotorworks.com 3 ... Vacuum secondaries Vacuum for: PCV, EGR, powerbrakes, distributor, air cleaner ... canisterElectricchokePowervalve blow-out protection ... choke, gaskets, and other "wear parts." Eachcarburetor is covered by a one-year ... to return your old carburetor. Specifyenginesize, year and horsepower. Carburetors ... Our Website For Additional Listings Of FuelLines 1. www.mamotorworks.com/corv ette ... Springs 1. www.mamotorworks.com/corv ette 2. SEARCH: GOACCELSPRING 3. CLICK ON: ... Part DescriptionFuelSystemSee our completeline of tune-up kits ...
our suppliers mann mahleare original equipmentmanufacturersthese brands are first- ... theyforgetsomethingchangethe oil every 3,000 miles using brand-name oil all ... ® model part oil filterspricesedreduc gas single gas 10 pack diesel ... singlediesel 10 pack eurovan `92-95 #sn01314 mann #sn11967 #sn1315 # ... filterstakethe dirt out of the air elementary if you re only going to keep your car ... until it reaches 50,000 miles don t evenbother changing it but if you want to ... s dirt in the air replace your car s fuelfilterevery six months or every 10,000 ... filterthe air the dirt gets into your enginemiles to protect its fuelsystem from ...
47
scirocco `77-92 daily driversectionfuelinjection is simple trust me [1 fuel ... tanks wesell a variety of excellentrecycled tanks specifyyearmodel gas ... from $60 call for quoteremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ... your vehicletheseitemsare sold on an exchange basis corecharges apply pre-pump two ... pump systems in 1985 vw® changed to a two pump ... systemthere is an in-tank pre-pumptransfer ... pump on many models it is part of thefuelsender and accessed from underthe ...
1-800-486-2681 w w w . B R O T H E R S P E R F O R M A N C E . c o m 21 ... AEROMOTIVE 5.0 Dynamic FuelSystems Back Half Kit Theperfectfuelsystem ... havebillet rails and/or an adjustablefuelpressureregulator. Comescomplete with ... the A1000 Fuel Pump, and our innovativesumped tank, ... plus braidedlines, hoseends, fittings, stainlesssteelcouplers, ... on a stock Mustang using the stock fuel supply line. Includes 11101 Pump. P/N ... ........................$ 1599.99 Eliminator Kit For 600-1600 HP naturally aspirated ... Consists of the Back Half Kit with theEliminatorFuel Pump, as well as braidedlines, ...
truck forceheadersfootnotes 1 this systemuses 21/4 o.d tubing werecommend ... using eitherthesupercompetitionaerochamber ... whenordering 3 factory 4 wheeldrive 4 exhaustsystems can also befabricated using ... eitherhookersupercompetitionaerochamber ... competition turbo mufflers or headertypehookermufflers 5 not legal for sale or ... use on vehicles originally equipped with catalytic converters for racing ... 8 installation on manual transmission equipped cars requires a hooker clutch linkage ... stock bracket 10 will not fit motors equipped with air injection pump without ...
modulesconversion kits e spark® conversion kits for mallory ... point distributors put an end to high maintenance point ignition ... systems by installing a proven mallory e spark ignition conversion kit by ... utilizing specializedelectronic circuitry and a infrared signal ... accurate ignition timing than any othertype of systemperiod · improvesperformance ... and fuelefficiency · easy to install with simple hand tools · ... mallory 4 6 and 8 cylinder point typeautomotive industrial and marine ... mechanicaladvance only cyl distributor typeyeardescriptionuse kit no 8 mallory ... 6 mallory all yl hp 24 25 seriesevenfire with stack style caps 61006m 6 ...
valve timing intelligence vvt-i electronicfuelinjectiondistributorlessdirect ... mechanicaldrive train 2.4 l dohc vvt-i engine 4 speed automatic transmission ... anti-skid brakes abs with electronicbrake-force distribution ebd and brake ... -arsekq ultima impor ta nt n ot i c epleasereadsafety cont glx ultima ... enginetypename configuration valvemechanismfuel ... system ignition displacement cc bore and ... kw/rpm sae max torque nm/rpm saefueleconomy l/100km adr81/01 glx ultima ... dealer prior to placing your order to ensurethevehicle you want is available ... toyota australia has used its bestendeavours to ensure that the information in this ...
i ntuit iv enewcamrycamrytechnicalspecific at ions engineeuro iv compliant engine ... typepetrolenginecode2az-feenginedisplacement 2362cc engine ... dohc with 4 valvespercylinder va lv emechanismvariablevalve timing with intelligence ... 117kw/5700rpm max torque 218nm/4000rpm fuelfuelsystemelectronicfuelinjection ... efifueltype 91 ron unleadedfueleconomy manual 8.9 l/100km fueleconomy ... automatic 9.9 l/100km exhaustvariableback-pressuremuffler ... on all gradessteeringsteeringsystem rack and pinion powersteering ... ab-i incorporating anti-skid braking system abs with electronicbrakeforce ...
-92 was upgraded with a larger 2100cc engine in 1986 and thenext major visible ... specific to this vehiclenote most everything is common to the syncro® of thesame ... year with a few minor exceptions such as transmissions front drive ... shafts shocks front exhaustpipe springs etc did you know that ... jack s forklift license cooling system coolant levelsensor at expansion tank ... #sn9066 .15.95 exp tank w/round side 025-121-407-a/b ... .44.95 exp tank w/flat side 025-121-407 .53.43 ... .39.95 cap for round-typeres 025-121-321-b/a .11.70 .8.60 ... fuelfilterfuelsystemfuelfilterin-line bosch #sn5072 .35. ...