master jaguar catalog fifteenthedition · table of contents · performance ... xks unltd performance parts 76-88 engineperformance and vintagerace ... conversions car accessories 24-27 exteriorbadgeslicenseframesleapers and ... fender trim exhaust/mufflers 90-91 headersstainless ... steelmufflers mirrors 28-30 exterior options and interior dash mounts ... windscreens and hood hold-downs engine cooling 94-95 flex-fanselectric fans ... performancehoses coolant catch tanks and alloy radiators lighting-electrical ... upgrades 42 air conditioning kits for e-type and earlysedanswheels knock-offs ...
31
e f g lemans 4 21/2 2 monza aston tankflange 17-1409 brass ring 17-1410 e ... flangeincluded `lemans 4 flip-top fuelfiller cap blank not drilledtank ... at theleftthe clasp is not a rollertype and there is no flangeincluded ... ii xj-6 flip-up oil cap 1 599 7-1 i e-typeroadsterluggage rack after many years ... supply this popular accessory fits all e-typeroadster don t wait too long d e-type ... san luis obispo ca 93401 u.s.a 27 moreexterior ...
gas tanksnewonepiecestretched smooth top ... steel gas tank for softail models this onepiece ... stretched gas tank will give your softail the long ... piece but an integral part of thetanktheexclusive zodiac stretchedtanks ... arethe only onepiecesteeltankavailable its design will give your ... a very classy look stretched softail tanksareavailable with dual and single ... screwtype gas cap dual or single quick-lock ... lockable gas cap as well as a tank with a single cap aircraft styleaero ... seat fits softail models 1984 thru 1999 tanks hold approx 4.2 gallon fuel 16 ltr gas ...
7
gas tanksonepiece 3 stretchedsteel gas tank ... 1999 this one-piece 3 stretched gas tank has a smooth top and a single midi aero ... cap placed on the right hand side this tankgives your bikethesame kind of ... styling as with the aluminum gas tanks but at a much moreeconomicalpricethe ... rear of thetank has a cut-out to match with most narrow ... seatstank holds approx 3.8 gallon 14 ltr and ... cap 011777 onepiece 3 stretched gas tank with aero locking gas cap stylee ... aero-style gas cap midi ventedstyleeonepiece 4 stretchedsteel smooth top ...
conditioning series ii air_conditioning e144e145-e147inner body panelsseries i ... ii roadster body continuede290-e298hosecoverplate a/c hose kit and ... i.d plates a/c fan switch and thermalexpansionvalve radio antennaantennabattery ... e242screen pillar assemblybulkheadpanels ... firewallassembly blanking plateextensionpanelsfillerpanelouterinnerpedal ... body panelsseries i ii coupe 2+2 e299-e303 manual antennarelay and electric ... six cylinderbatterycomponents v-12 e240e241battery support bracket ground ...
5
for replacement parts door fittings lwb e-types 2+2 body continuede340 hand brake ... series i ii brakescontinuede209outer door t seal door hinge door ... door fittings series iii v-12 roadstere341e342e343e344e345e346-e351e352-e357 ... e358-e363e364-e368 mounting plateassemblyhandbrake ... bracket hand brakeseries iii v-12 e210e211 glass door hinge door chrome glass ... handbrake switch cablemiscellaneouse-typebrakecomponentsrearview mirrors ... windshields door glass carburetorse52-e55windshields door glass and rear hatch ... chamber manual choke rod carburetorfuel rail chamber lid gasket vacuum tube ...
data is not yetavailable for theseengines and will bepublishedonceavailable ... ps or pferdestärke which is themetricequivalent of horsepower to convert from metric ... dividethe ps figure by 1.0139 for example 240 ps is equivalent to 237 bhp e ngi n ... eenginetype cubic capacity ltrs/cc bore/stroke mm ... .0 1 6 speed auto tiptronic 190 480 85 environme ntal i n formation fuelgrade ... minimum fueltank capacity galls/ltr official fuel ... consumption mpg/ltr per 100 km 06 urban extra-urbancombined official co 2 emission g/km 07 ... emission class noise db 21.9/12.9 36.7/7.7 29.4/ ... 9.6 259 euro 4 69 diesel 51 cn 04 19.7/90 02 figures ...
26
data is not yetavailable for theseengines and will bepublishedonceavailable ... ps or pferdestärke which is themetricequivalent of horsepower to convert from metric ... dividethe ps figure by 1.0139 for example 240 ps is equivalent to 237 bhp e ngi n ... eenginetype cubic capacity ltrs/cc bore/stroke mm ... .3 1 6 speed auto tiptronic 190 480 85 environme ntal i n formation fuelgrade ... minimum fueltank capacity galls/ltr official fuel ... consumption mpg/ltr per 100 km 06 urban extra-urbancombined official co 2 emission g/km 07 ... emission class noise db 16.1/17.5 31.4/9.0 23.2/ ... 12.2 293 euro 4 69 unleaded 95 ron 05 19.7/90 02 ...
fuelsystem 6 7 10 8 9 30 5 5a 2 17 16 26 25 ... 27 28 29 carburetors/fuelsystem 11 11 1 4 3 18 19 21 22 17 17 15 ... 20 17 15 23 24 11 21 22 12 xk-150 s fueltank fittings 1 2 3 4 5 6 7 8 9 fuel ... tanksteel 03-0092 fuelfillerhose 18-0028 fueltank drain ... for plug c26310 mount stud front of tank c8368 sending unit fuelnew ... w gasket 10-ft5340-03 sending unit fuelrebuilt original 10-ft5340-03/rb ... gasket only for fuelsending unit neoprene ja-btj2953 ... gasket for fuelsending unit cork sm-31-754-119spr 17 ... grommet mounting fuel pumps c974 18 banjo bolt flexpipe to ... banjo bolt centerpipe to inlet of rearfuel pump and front pipe to outlet of front ...
15
fuelsystem 20 21 19 10 11 20 21 19 1 2 3 5 ... 12 28 13 24-26 23 22 24-26 carburetors/fuelsystem 40 12 29 16 4 44 15 17 18 14 39 ... 36 43 35 8 9 42 23 32 33 38 37 24-26 27 fueltanks fittings e-typeseries i ii 1 2 ... 3 4 fuelfiller cap 3.8 series i c9024 fuel ... ii c23601 fillerhose all c18936 fueltankseries i earlyseries ii 03-0093 ... series i and earlyseries ii tankshave a singleventnipple on top later ... havethree small nipples on thesidefueltankseries ii from ots 1r.20486 fhc 1r ... -0094 5 6 7 8 9 sending unit universaltype all sm-tb9006kit sealsending unit to ...
92 Pu rs u e yo u r pas s i on fo r A i r- Co o l e ... d V W h ere Toll Free: 800.500.1500 10 FusePackage ... , includes 10 fuses of each: 8 amp (white), 16 amp (red) 25 amp ( ... G 20 FusePackage, includes 20 fuses of each: 8 amp (white), 16 amp (red) 25 amp ( ... ) 106-820 $12.99 I K J L H G A FusesFuelGauges And Sending Units H Beetle 49-61 ... Extension, fuel tap 361-100 $44.99 I Beetle 62-67 Fuel ... 302-669 $44.99 J Btl 68-77, Spr 71-79 FuelGauge, in speedo 302-672 $39.99 K Btl ... 68-77, Spr 71-79, Ghia 68-74 Vibrator, fuelgauge, for OEMgauge 302-675 $24.99 ... 68-77, Ghia 73-74 GaugeSending Unit, electricfuelgauge, OEM 379-487 $24.99 L Super ...
131
123 Pu rs u e y o u r pas s i o n fo r A i r- Co o l ... e d V W h ereUnderhood 7 www.mamotorworks.com ... FuelDoes not come with screens, complete ... theproject with 301-696 (E). A B C D E F G H J K I FuelTanks, Filters And ... HardwareFuelTank A Vanagon 80-92 gas only 50mm filler ... , cut original neck and weld onto newtank 300-857 $59.99 Super 71-74 300-860 $99. ... 99 Super 75-79 dual feed, fuelinjected 300-863 $99.99 C Bus 55-67 w/ ... 60mm neck 313-210 $69.99 FuelFilter D Btl 50-74, Spr 71-74, Ghia 56- ... 74, Bus 50-79, Type 3 63-67 in-lineuniversalclear 300-785 ... 77, Spr 75-79, Bus 75-79, Vanagon 80-85 fuelinjected, 16-2000cc 390-903 $4.99 Bus ...
supergluelike stuff which is includedfuelhosehighest quality braidedgerman ... fuelhose sold by themeter [d inside diam.3 ... all sn5105 .18.30 .13.95 [e gas cap for all type i® 1971 on-screw ... in styletype iii® dasher® and fox® wagons and all ... ® `76-79 and scirocco® `76-81 screw-intype sn1639 .12.05 .7.95 [i ... .29.95 .14.95 [l gas cap eurovan® sn14976 .call [n gas cap ... able to dump out the mat and she didn t even know proof only weathertech® mats give ... and sand weathertech® mats are original equipment in the world s finest cars and are ... #sn5613 fox® `87-93 #sn5608 #sn5613 eurovan® `90 04 #sn19982 #sn19983 custom made ...
46
fuelinjection daily driversection [1 fueltankswesell a variety of excellent ... recycledtanksspecifyyearmodel gas or diesel 2 year ... to a two pump systemthere is an in-tankpre-pumptransfer pump on many models ... it is part of thefuelsender and accessed from underthe ... plateunderthe back seatfuelpre-pumpcabriolet `85-93 golf `85-92 ... ® ® is simple trust meremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ...
gt 1000 motoreengine bicilindrico a l distribuzione ... -ft 9.3kgm 6000rpm .25 alimentazionefuelinjectioniniezioneelettronicamarelli ... corpo farfallato 45 mm marellielectronicfuelinjection 45mm throttle body ... scarico exhaust impianto di scarico in acciaio inox ... lateralichromedstainlesssteelexhaustsystem with onemufflerperside ... omologazioni emissionseuro 3 tipo typetrasmissione transmission cambio ... sospensioneanteriore front suspensionescursione ruota anteriore front wheeltravel ... -down fork capacità serbatoiobenzinafueltank capacity 15 lt di cui 3,5 di ...
10
sport 1000 motoreengine bicilindrico a l distribuzione ... -ft 9.3kgm 6000rpm .25 alimentazionefuelinjectioniniezioneelettronicamarelli ... corpo farfallato 45 mm marellielectronicfuelinjection 45mm throttle body ... scarico exhaust impianto di scarico nero con due ... silenziatorilaterali black exhaustsystem with onemufflerperside ... omologazioni emissionseuro 3 tipo typetrasmissione transmission cambio ... sospensioneanteriore front suspensionescursione ruota anteriore front wheeltravel ... -down fork capacità serbatoiobenzinafueltank capacity 15 lt di cui 3,5 di ...
fuelinjection daily driversection [1 fueltankswesell a variety of excellent ... recycledtanksspecifyyearmodel gas or diesel 2 year ... to a two pump systemthere is an in-tankpre-pumptransfer pump on many models ... it is part of thefuelsender and accessed from underthe ... plateunderthe back seatfuelpre-pumpcabriolet `85-93 golf `85-92 ... ® ® is simple trust meremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ...
8
e t ch t ip daily driversection hot ... start problemnewfuelpressure accumulator all rabbit® ... jettas® dashers® golfs® quantum® audis® etc from `77 through approximately `88 have ... cis fuelinjection continuous injectionone of ... you turn off the car theheat from theengine and exhaustpipe soaks into the ... an air space in thelinebetweenthefueltank and the pump and the pump can t ... to this problemone of which was thefuelpressure accumulator thefuelpressure ... whenthe pump is turned on thefuel pump pressurecompressesthe spring ...
Cannot vapor lock. Reliableoperation. Eliminatesdangerousventing of fueltanks during ... filling. Pumps with ease against a differentialpressure of 50 ... polished tool steelValvesOnepoppettypevalve in piston and one high pressure ... checkvalve. Packing extra long packing gland 5/16 special V ring ... ring. HandleLength 2, plus 2 extensionWeightApproximately 54 Lbs. Shipping ... and pin, and 1 set of packing. An economical way in which to transfer, evacuate or ... purgetanks. Environmentallyfriendly, oncetheconnectionsaremade ... pump from damage, use this unit for evacuatingtanks. Capacity 18 to 50 GPM depending ...
245
I ON THEWEBwww.nee.caMotorfuelTanksNEE # Description Cross Reference No. ... of tanksDiameter x Length Capacity (Ltrs) ... 1010103526HSEASSierraTank 211347 3 10 X 35 (2), 10 X 26 (1) 90 ... 10101039HBEASUnderbodyTank 22607.1 3 10 X 39 (3) 107 111140HBACAS ... Double Manifold Tank 27524 2 11 X 40 (2) 93 1113133634HSEAS ... Maxi Van Tank 218947+.1 3 11 X 37 , 13 X 36 , 13 X 34 ... 169 121030HSEASUnderbodyTank 233947.1 2 12 x 30 , 10 x 30 69 ... 1250HETASUnderbodyTank 22987.2 1 12 X 50 69 1261HEFAS ... UnderbodyTank 29377.2 1 12 X 61 85 1265HEFAS ... UnderbodyTank 202147.1 1 12 x 65 86 1272HBCAS ... UnderbodyTank 225547.1 1 12 X 72 102 131030HSEAS ...
e s 1.2 litre 55 ps technical ... specificationengineenginetype cubic capacity ltrs/cc bore/stroke mm ... ps or pferdestärke which is themetricequivalent of horsepower to convert from metric ... vehicleunladenweightranges with 90 tank capacity without driver 75 kg the ... with increasingaltitudetheengineperformancediminishes from 1,000 m ... abovesealevel and for every 1,000 m thereafter 10 of thevehicle/ ... unleaded in order to achieve maximum fuel consumption benefits on the fsi engine ... petrol ulsp must beused official fuel consumption according to eudirective ...
22
e s 1.2 litre 64 ps technical ... specificationengineenginetype cubic capacity ltrs/cc bore/stroke mm ... ps or pferdestärke which is themetricequivalent of horsepower to convert from metric ... vehicleunladenweightranges with 90 tank capacity without driver 75 kg the ... with increasingaltitudetheengineperformancediminishes from 1,000 m ... abovesealevel and for every 1,000 m thereafter 10 of thevehicle/ ... unleaded in order to achieve maximum fuel consumption benefits on the fsi engine ... petrol ulsp must beused official fuel consumption according to eudirective ...
multistrada 1100 motoreengine tipo type bicilindrico a l distribuzione ... .5kgm 102.9nm 4750rpm alimentazionefuelinjectioniniezioneelettronicamarelli ... corpo farfallato 45 mm marellielectronicfuelinjection 45mm throttle body ... scarico exhaustmonosilenziatore in acciaio e ... presilenziatore con catalizzatoree sonda lambda singlesteelmuffler and ... and lambda probe omologazioni emissionseuro 3 trasmissione transmission ... sospensioneanteriore front suspensionescursione ruota anteriore front wheeltravel ... frame 1462 mm 57.6in 24° 35° dx e sx 35° right and leftforcella showa a ...
18
multistrada 1100 s motoreengine tipo type bicilindrico a l distribuzione ... .5kgm 102.9nm 4750rpm alimentazionefuelinjectioniniezioneelettronicamarelli ... corpo farfallato 45 mm marellielectronicfuelinjection 45mm throttle body ... scarico exhaustmonosilenziatore in acciaio e ... presilenziatore con catalizzatoree sonda lambda singlesteelmuffler and ... and lambda probe omologazioni emissionseuro 3 trasmissione transmission ... frame 1462 mm 57.6in 24° 35° dx e sx 35° right and leftforcella Öhlins ... adjustableupside-down fork with tin escursione ruota anteriore front wheeltravel 165 ...
units oil pressuresending units e-typeseries i ii mk ii 3.8s mk x 3.8 mk x 4 ... .2 420 420g c15474 e-type v-12 xj-6 xj12 up to 1976.5 vins 2t. ... 5.3 6.0 v-12 1992-on x300 xj-6 to engine b.134019 ja-jlm20791 x300 4.0 from ... engine b.134020 x300 6.0 v-12 all ja- ... lna5642ca xk8 xj-8 ja-aj8-4853 fueltanksending units yearmodel xk-120 xk-140 ... xk-150 1961 1974 tank unit 10-ft5386-02 10-ft5340-03 seal ja- ... btj2953 ja-btj2953 lock ring n/a n/a e-typeseries i ii iii mk vii-mk ix sm- ... right c21973/rb left c21974/rb fuelsendergasket and screwsgasket ja- ... oil levelsending unit front mountedexternal pumps c27738 rh c27739 lh ja-mtu151 rh ... ja-ara1501/j ja-ara1502 ja-ara1501/j electrical/switches oil pan oil levelrebuilt only ...
26
have a b afterthe part numbereachwire is insulated with braidedthread ... is lacqueredper original style both typeshavewiresbundled in cloth of the ... original color and pattern xk-120 early without turn indicators pvc 08-0101 ... xk-120 earlybraided 08-0101b xk-120 late with ... 08-0103b xk-140 overdriveharnessearly two relays pvc 08-0190 as above ... harnessbraided 08-0192b xk-150 early w small lamps 4-spd pvc 08-0104 xk- ... 150 early4-speedbraided 08-0104b xk-150 early ... automatic pvc 08-0804-1 xk-150 early automatic braided 08-0804-1b xk-150 ... braided 08-0105-1b wiring harnessese-type 1 2 5 5 3 4 1 2 3 4 5 6 wiring loom ...
® all #sn5105 19.95 [e gas cap for all type i® 1971 on-screw ... in styletype iii® dasher® and fox® wagons and all ... ® `76-79 and scirocco® `76-81 screw-intype #sn1639 .7.95 [i gas ... 14.95 [l gas cap eurovan® #sn14976 call [n gas cap ... able to dump out the mat and she didn t even know proof only weathertech® mats give ... and sand weathertech® mats are original equipment in the world s finest cars and are ... front rearset 79.95 248 373-2300 fuelhosehighest quality braidedgerman ... fuelhose sold by themeter [d insidediam.3. ... #sn5613 fox® `87-93 #sn5608 #sn5613 eurovan® `90 04 #sn19982 #sn19983 custom made ...
47
scirocco `77-92 daily driversectionfuelinjection is simple trust me [1 fuel ... tankswesell a variety of excellentrecycledtanksspecifyyearmodel gas ... from $60 call for quoteremanufacturedfuelinjectioncomponentsarelessexpensive ... ask your salesman if a remanufacturedfuel pump warm-up regulatoridlestabilizer ... your vehicletheseitemsare sold on an exchange basis corecharges apply pre-pump two ... to a two pump systemthere is an in-tankpre-pumptransfer pump on many models ... it is part of thefuelsender and accessed from underthe ...
com 63 oRdeR toLL FRee 1 800 228 7346 FueLLines by Add SS to end of part number ... take two to four weeks for delivery. Fueltank to pump Line original stainless ... .............79.95 .......... 129.95 Fuel vapor Line 71 73 5/16 ... .............79.95 .......... 129.95 FuelventLineset 71 73 Two piece ... .............54.95 ............ 64.95 FueLHose and cLamp kit Reproduction kit ... : threefeet of 1/4" diameteruniversalfuelhose, eight color codedspring-type ... and eightkeystone-style pinch clamps. 67 73 ... kit.. ......... 10.95 FueLsendeRwiRecoveR kit 67 68 ... kit............. 6.00 FueLsendeRHaRdwaRe Brass float ...
66
oRdeR toLL FRee 1 800 228 7346 64 FueLtankFiLLeRpipeseaLs 71 72 Fuelfiller ... pipe to tankseal ... D1ZZ-9072................ ..ea .......... 19.95 71 73 Fuelfillerpipe ... D1ZZ-9008................ ..ea .......... 25.95 FueLtanks and mount ... scRews 67 68 16 gallon tank. U.S.A. made. Reproduction without drain ... C5ZZ-9002................ ..ea ........ 109.95 67 68 Same as above ... except with drain plug for show cars ... C5ZZ-9002D ...............ea ........ 124.95 69 20 gallon tank. ... C9ZZ-9002................ ..ea ........ 149.95 70 22 gallon tank. ... D0ZZ-9002A ...............ea ........ 149.95 71 73 20 gallons ... D1WY-9002A ..............ea ........ 199.95 Fueltank mounting ...
hypermotard 1100 motoreengine tipo type bicilindrico a l distribuzione ... 76 lb-ft 10.5kgm 4750rpm iniezioneelettronicamarelli corpo farfallato 45 mm marelli ... electronicfuelinjection 45mm throttle body impianto ... 1 in 2 alleggerito con catalizzatoree sonda lamba lightweight 2-1-2 system ... catalytic converter and lambda probeeuro 3 ruota anteriore front wheel ... ad attacco radiale a 4 pistoncini e 2 pastiglie 2 x 305mm semi-floating ... olio livellobatteria spia riserva trip fuel spia frecce spia folle diagnostica ... pressure warning light batteryvoltagefuelreserve warning light trip fuel ...
heating tough tank duff co oil tanks 14 gaugesteelfinishedredprimer ul ... toughtank for indoor or outdoor useexclusivedesignverticalheatingfueltanks ... and weldprotection horizontal heatingfueltanks withstands internalpressures ... will or in crawl spaces occur if tanksareoperated in nom descr fig no dia ... lgth priceexcess of normal operatingprescap gal sure 2 ... 1.2 psi tanksbear a ul 192 vertical 50629 28 76 80 ... 7 6 for storage of homeheating oil tanksarepainted with redprimer and are ... in other colors on requestlegsfuelhopperstate of the art technology for ...
848 motoreengine bicilindrico a l distribuzione ... 70.8lb-ft 96nm 8250rpm alimentazionefuelinjectioniniezioneelettronicamarelli ... corpi farfallati ellitticimarellielectronicfuelinjectionellipticalthrottle ... bodies scarico exhaust impianto di scarico 2 in 1 in 2 ... alleggerito con catalizzatoree sonda lambda duesilenziatori in ... stainlesssteelmufflers omologazioni emissionseuro 3 trasmissione transmission ... multiplate with hydraulic control tipo typeveicolo chassis telaioframe ... sospensioneanteriore front suspensionescursione ruota anteriore front wheeltravel ...